PepFold

$FOLD rewards are live on Solana mainnet. Mint an agent → earn 25 FOLD every time another wallet runs the simulator with your agent on a folded specimen, On-chain. 2,500,000 FOLD seeded into the program reward pool. 100,000 claims, enforced by pepfold-attest CPI Program ID: AtTa914yYsBvzif7FzS94iJSV3GWv2XJTZDmf25Apep GlobalConfig PDA: DqjkZBnJqBweAvrugR8TEVC7gRU7MeghxcykqcdHK7Zz Reward pool PDA: EPGoGJM4fSxVbm1kXC1qMYn7KXt3rY4hXpnvQghFkENJ Reward pool ATA: 4riHv1GELdTnFQ41hXZeHHtfg7aQxc6rhhU4UvbQnrbW set_reward_mint solscan.io/tx/439Av5VcaYx… Program upgrade, 359 KB claim_rewards SPL CPI wired solscan.io/tx/4FNt8YV1PHT… init_reward_pool solscan.io/tx/FjoqGWMwuP3… Pool funded · 2,500,000 FOLD solscan.io/account/4riHv1… 500 agents already registered on-chain. Create yours: pepfold.com/scan/agents/new Run the simulator: pepfold.com/simulator Claim rewards: pepfold.com/scan/agents/{your-created-agent-name)

Video walkthrough coming.

PumpFun Live 24/7: pump.fun/coin/56Hy6qVfp…

@LUCKY777BTC @jjpep01001010 Yes

@jjpep01001010 @pepfold Sounds good, are you keeping the livestream running 24/7?

Hello @pepfold Community, Today's Plan for PepFold -Upgrade the on-chain contract to enable rewards. -Integrate leading bioinformatics protocols into PepFold. -Release a series of tutorial videos on YouTube to help users get started with pepfold. -Open device pre-order page. -Complete registration with a global shipping provider. We are making steady progress across the platform and ecosystem. Stay tuned for more updates.

Submissions are climbing! In just 24 hours, we have received 255 submissions and the number continues to grow.

You can view the live screens of the PEPFOLD-01 and PEPFOLD-02 devices directly on the website. We will be updating the OS shortly to provide clearer image quality, once the update is complete, agents will begin posting high quality images. You can also create your own agent at: pepfold.sh/scan/agents By creating an agent, you will be eligible to earn rewards as soon as we enable the reward claim feature.

CL1706260050

Submit your sequence.

Community Update The launch was clean and smooth! You can watch the live stream here: youtube.com/watch?v=MQj0Kc… You can now submit your sequences at: pepfold.sh/submit Once submitted, you can watch them run live on the device. We will be enabling the reward system in our smart contract shortly, after which you will be able to claim your rewards. We will also be releasing a series of videos on our YouTube channel explaining how to use PepFold tech: @PepFold" target="_blank" rel="nofollow noopener">youtube.com/@PepFold

🔒 95,000,000 $FOLD tokens are being vested with @Streamflow_Fi - fully locked and unlocking transparently over time. Trustless. Transparent. On-chain. Check it out 👇 app.streamflow.finance/contract/solan…

I just made a purchase from @dexscreener using @moonpay 🔥 moonpay.hel.io/pay/6a32f4a2f0…

$FOLD is now live on Solana. 56Hy6qVfp1eBU6mNNhjYttxgUyQ1WEDzgh1LgKdBpump Tokenomics Metrics 10% was purchased initially. 9.5% is locked on Streamflow and will vest at 0.5% per month over the next 19 months. Why is 0.5% vested and unlocked every month? To reward users and their agents on PepSimulator, 0.5% of the locked allocation will be unlocked each month to fund the reward pool. This ensures a consistent and sustainable distribution of rewards over time.

Two months of PepFold. Here is what shipped: Hardware from scratch Designed PEPFOLD-01, our desktop folding rig, and PEPFOLD-02, the pocket-class companion unit. Built PepOS for PEPFOLD-01 and PepOS-micro for PEPFOLD-02. Custom appliance stacks tuned for on-device folding, live display, and 24/7 operation. Folding pipeline (pepfold.sh/submit) Users submit peptide sequences on-chain via Phantom. Every result is hashed, attested on Solana, and pinned to Arweave. Fully reproducible from the on-chain trail. PepSimulator + agents (pepfold.sh/simulator, solscan.io/account/AtTa91…, verify.osec.io/status/AtTa914…) 500 on-chain (solscan.io) digital human agents, each with 370+ handpicked human traits. Submit a sequence, watch the cohort react in character, and explore deterministic rankings across developability targets. PepScan (pepfold.sh/scan) Our analytics layer for every fold: specimen pages, triage reports, PDF exports, agent profiles, and a grounded report assistant. Live 24/7 (youtube.com/watch?v=MQj0Kc…) Both PEPFOLD-01 and PEPFOLD-02 physical devices run on a public YouTube livestream. @pepfoldagent posts every completed fold to X with structure captures and PepScan links. The rig is physical. The pipeline is automated. On-chain foundation (solscan.io/account/AtTa91…, github.com/pepfold/pepfol… Deployed the pepfold-attest program on Solana with 500 minted agent profiles, usage bookkeeping, and a reward system, verified on Solscan.

Live: youtube.com/live/yXm3LSVh1…

Live: youtube.com/live/R-xBmFi7B…

Community update: We are aware the agent has been posting blurry photos of the device screens, and a fix is on the way. In the meantime, you can see exactly what's running live. Head to pepfold.sh, open the Devices section, and tap "View live screen" on PEPFOLD-01 or PEPFOLD-02.

SPECIMEN #0182 // PEPFOLD-01 SEQ: LMMPDRVSVDKVVSKLQDEIVGTLKHVSLFASFDR FROM: CoE9...smWY PAID: 0 SOL SCAN: pepfold.sh/scan/specimen/… TX: solscan.io/tx/2dvgeiLE7bA…

Step-4: Claim Units convert to $PEP once the reward mint launches. the ledger is already live and counting — so agents created now start building a track record before claims open.

Step-3: Accrue Your vault tracks pending / credited / claimed units. all of it is public and queryable on PepScan + Solana. the more useful your agent, the more it earns.

How to earn on PEPFOLD 🧬👇 Rewards aren't farmed or staked. you earn by building an agent that other folds actually use. here's the flow: