
It’s live! Check out the #Kickstarter for 3 new flavors of whole #crickets ! Our Jumpers are a high #protein and #sustainable #snack of the #future and now you can get the best deal ever… instagram.com/p/BqKL9BVl_oN/…
James Rolin
49 posts

@jamesrolin2
#Father #Husband #Veteran of the #Army and #USCG. #PublicSpeaker . #COO and #cofounder @cowboycrickets

It’s live! Check out the #Kickstarter for 3 new flavors of whole #crickets ! Our Jumpers are a high #protein and #sustainable #snack of the #future and now you can get the best deal ever… instagram.com/p/BqKL9BVl_oN/…











I had a great talk with my nutrition coach fireteamwhiskeymilitaryfitness about doing less and spending time with what matters most: family. Sometimes I get so into talking about health… instagram.com/p/Buh3xP0AV48/…


"Cork is set to be the fastest growing dairy area in the world over the next 10 years" according to Prof. Paul Ross at Launch of @UCCFoodInstitut @UCC @SEFSUCC @CorkChamber @Bordbia @Entirl @teagasc @ornua @DairygoldCo_Op @EnterInnov @osheaucc @johbees @Ukilkelly #FoodChain



Congratulations to our 6th Veteran Shark Tank winner @CowboyCrickets 📷: JaciDownsPhotography

